PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DS_6354FF359.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 60aa    MW: 7080.93 Da    PI: 4.319
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DS_6354FF359.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR125.73.7e-082560136
                   FAR1  1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCs 36
                           +fYneYA e GFsvrks+ +    n+ i+ r+ vCs
  Traes_7DS_6354FF359.1 25 EFYNEYALEKGFSVRKSYVEWDGSNKYIILRKIVCS 60
                           6**********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.9E-62560IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 60 aa     Download sequence    Send to blast
ATDESMFEYL NVVSKMFDSE AEGYEFYNEY ALEKGFSVRK SYVEWDGSNK YIILRKIVCS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703063e-88HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231784.23e-21PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLW5I7T65e-37W5I7T6_WHEAT; Uncharacterized protein
STRINGBRADI2G37795.11e-20(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2449976
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]